Proteintech, 12343-1-AP, S100A3 Polyclonal antibody

Size: 20ul / 150ul The S100A3 (12343-1-AP) by Proteintech is a Polyclonal antibody targeting S100A3 in WB, ELISA applications with reactivity to human, mouse samples 12343-1-AP targets S100A3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A2780 cells, HeLa cells, mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2995 Product name: Recombinant human S100A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC012893 Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ Predict reactive species Full Name: S100 calcium binding protein A3 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 7 kDa, 12 kDa GenBank Accession Number: BC012893 Gene Symbol: S100A3 Gene ID (NCBI): 6274 RRID: AB_2183761 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P33764 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.