Proteintech, 12347-1-AP, MAGOH Polyclonal antibody

Size: 20ul / 150ul The MAGOH (12347-1-AP) by Proteintech is a Polyclonal antibody targeting MAGOH in WB, IHC, IP, ELISA applications with reactivity to human samples 12347-1-AP targets MAGOH in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, HL-60 cells, human brain tissue, Raji cells Positive IP detected in: K-562 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MAGOH, belonging to the mago nashi family, is a component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). MAGOH regulates the transcriptional activation of STAT3 by interfering complex formation between STAT3 and a core EJC component Y14. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3004 Product name: Recombinant human MAGOH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC018211 Sequence: MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI Predict reactive species Full Name: mago-nashi homolog, proliferation-associated (Drosophila) Calculated Molecular Weight: 146 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC018211 Gene Symbol: MAGOH Gene ID (NCBI): 4116 RRID: AB_2265988 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61326 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.