Iright
BRAND / VENDOR: Proteintech

Proteintech, 12350-1-AP, LIMK2 Polyclonal antibody

CATALOG NUMBER: 12350-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LIMK2 (12350-1-AP) by Proteintech is a Polyclonal antibody targeting LIMK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12350-1-AP targets LIMK2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The family of LIM kinase (LIMK) includes two similar proteins, LIMK1 and LIMK2, that share overall identity of 53% with 75%, 55%, and 42% amino acid identity in the LIM, kinase, and PDZ domains, respectively. LIMK2 regulates actin cytoskeletal reorganization through phosphorylating and inactivating cofilin, an actin-depolymerizing factor of actin filaments. It also may associate with gamma-tubulin and play a role in mitotic spindle assembly. High levels of LIMK2 are evident in uterus, thymus, and spleen whereas lower levels are observed in brain, heart, liver, stomach, skeletal muscle, and testes according to the results of western blotting(PMID:16399995). It has 3 isoforms produced by alternative splicing of the molecular weight of 70-78 kDa. It can be detected a band of 47 kDa or 50-55 kDa in the testes because the antibody is recognizing the testis-specific variant of LIMK2 and the this difference could be due to species variation(PMID:17928627). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3011 Product name: Recombinant human LIMK2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 379-686 aa of BC013051 Sequence: KLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRAPPGAAGEGPGCADDEGPVRRQGKVTIKYDPKELRKHLNLEEWILEQLTRLYDCQEEEISELEIDVDELLDMESDDAWASRVKELLVDCYKPTEAFISGLLDKIRAMQKLSTPQKK Predict reactive species Full Name: LIM domain kinase 2 Calculated Molecular Weight: 686 aa, 78 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC013051 Gene Symbol: LIMK2 Gene ID (NCBI): 3985 RRID: AB_2137094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53671 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924