Proteintech, 12356-1-AP, AKAP10 Polyclonal antibody

Size: 20ul / 150ul The AKAP10 (12356-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP10 in WB, IHC, ELISA applications with reactivity to human samples 12356-1-AP targets AKAP10 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells Positive IHC detected in: human colon cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3020 Product name: Recombinant human AKAP10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 314-663 aa of BC017055 Sequence: IPITEAMRNDIIARICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLTAPGSVGPPDESHPGSSDSSASQSSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDIMQQAQYDQPLEKSTKL Predict reactive species Full Name: A kinase (PRKA) anchor protein 10 Calculated Molecular Weight: 662 aa, 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC017055 Gene Symbol: AKAP10 Gene ID (NCBI): 11216 RRID: AB_2225588 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43572 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.