Iright
BRAND / VENDOR: Proteintech

Proteintech, 12366-2-AP, KPNA6 Polyclonal antibody

CATALOG NUMBER: 12366-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KPNA6 (12366-2-AP) by Proteintech is a Polyclonal antibody targeting KPNA6 in WB, IHC, ELISA applications with reactivity to human samples 12366-2-AP targets KPNA6 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3040 Product name: Recombinant human KPNA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-536 aa of BC020520 Sequence: EQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL Predict reactive species Full Name: karyopherin alpha 6 (importin alpha 7) Calculated Molecular Weight: 536 aa, 60 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC020520 Gene Symbol: KPNA6 Gene ID (NCBI): 23633 RRID: AB_2281067 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60684 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924