Iright
BRAND / VENDOR: Proteintech

Proteintech, 12371-1-AP, EBI3/IL-27B Polyclonal antibody

CATALOG NUMBER: 12371-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EBI3/IL-27B (12371-1-AP) by Proteintech is a Polyclonal antibody targeting EBI3/IL-27B in WB, IHC, IP, ELISA applications with reactivity to human, pig samples 12371-1-AP targets EBI3/IL-27B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: human placenta tissue, pig spleen tissue Positive IP detected in: human placenta tissue Positive IHC detected in: human spleen tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information EBI3, a 34-kDa secreted glycoprotein, is a subunit in 2 distinct heterodimeric cytokines: IL-27 and IL-35. IL-27, composed of p28 (IL-27) and EBI3, can trigger signaling in T cells, B cells, and myeloid cells. IL-35, composed of EBI3 and the ubiquitously expressed p35 subunit of IL-12, is an inhibitory cytokine involved in regulatory T-cell function. EBI3 plays a role in regulating cell-mediated immune responses. (PMID: 8551575; 18033300; 17874423; 21931777) Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3051 Product name: Recombinant human EBI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC015364 Sequence: MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK Predict reactive species Full Name: Epstein-Barr virus induced 3 Calculated Molecular Weight: 229 aa, 25 kDa Observed Molecular Weight: 25-35 kDa GenBank Accession Number: BC015364 Gene Symbol: EBI3 Gene ID (NCBI): 10148 RRID: AB_10646470 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14213 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924