Proteintech, 12379-1-AP, SF3B14 Polyclonal antibody

Size: 20ul / 150ul The SF3B14 (12379-1-AP) by Proteintech is a Polyclonal antibody targeting SF3B14 in WB, ELISA applications with reactivity to human, mouse, rat samples 12379-1-AP targets SF3B14 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Pre-mRNA splicing by the human spliceosome requires the sequential recognition by RNA and protein factors of the 5′ and 3′ splice sites,the branch region and the polypyrimidine tract. This sequence is characterized by the stepwise association of the U1, U2, and U4/U5/U6 snRNP particles [PMID:9476892]. Human p14 (SF3b14), a component of the spliceosomal U2 snRNP, interacts directly with the pre-mRNA branch adenosine within the context of the bulged duplex formed between the pre-mRNA branch region and U2 snRNA. This association occurs early in spliceosome assembly and persists within the fully assembled spliceosome [PMID:21062891]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3045 Product name: Recombinant human SF3B14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC015463 Sequence: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK Predict reactive species Full Name: splicing factor 3B, 14 kDa subunit Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC015463 Gene Symbol: SF3B14 Gene ID (NCBI): 51639 RRID: AB_2186517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3B4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.