Iright
BRAND / VENDOR: Proteintech

Proteintech, 12396-1-AP, RGS13 Polyclonal antibody

CATALOG NUMBER: 12396-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RGS13 (12396-1-AP) by Proteintech is a Polyclonal antibody targeting RGS13 in IHC, IP, ELISA applications with reactivity to human samples 12396-1-AP targets RGS13 in IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Ramos cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Regulator of G-protein signaling 13 (RGS13) is an R4 subfamily member that attenuates both Gαi and Gαq-dependent signaling including chemokine reponses in B cells (PMID: 11875076, PMID: 12193720). RGS13 interacted with both Gialpha and Gqalpha and strongly impaired signaling through G(i)-linked signaling pathways, including signaling through the chemokine receptors CXCR4 and CXCR5 (PMID: 12193720). Human mast cells express multiple RGS proteins, of which RGS13 is among the most abundant (PMID: 19017978). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3077 Product name: Recombinant human RGS13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-159 aa of BC016667 Sequence: MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF Predict reactive species Full Name: regulator of G-protein signaling 13 Calculated Molecular Weight: 159 aa, 19 kDa Observed Molecular Weight: 17-19 kDa GenBank Accession Number: BC016667 Gene Symbol: RGS13 Gene ID (NCBI): 6003 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14921 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924