Proteintech, 12412-1-AP, GSTM1 Polyclonal antibody

Size: 20ul / 150ul The GSTM1 (12412-1-AP) by Proteintech is a Polyclonal antibody targeting GSTM1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12412-1-AP targets GSTM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HeLa cells, mouse kidney tissue, mouse ovary tissue, rat liver tissue Positive IHC detected in: mouse liver tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GSTM1 belongs to the superfamily of glutathione-Stransferases (GSTs) of phase 2 enzymes that catalyze a number of distinct glutathione-dependent reactions. GSTM1 gene has been a natural candidate in studies of susceptibility to inflammatory airway diseases with environmental components because of the high prevalence of the null polymorphism and its role in detoxification (PMID: 22683820). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3113 Product name: Recombinant human GSTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC024005 Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK Predict reactive species Full Name: glutathione S-transferase mu 1 Calculated Molecular Weight: 181 aa, 21 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC024005 Gene Symbol: GSTM1 Gene ID (NCBI): 2944 RRID: AB_2115925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.