Proteintech, 12430-1-AP, RNGTT Polyclonal antibody

Size: 20ul / 150ul The RNGTT (12430-1-AP) by Proteintech is a Polyclonal antibody targeting RNGTT in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 12430-1-AP targets RNGTT in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue Positive IP detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RNGTT(mRNA-capping enzyme) is also named as HCAP1, HCE, CAP1A. In the N-terminal section it belongs to the non-receptor class of the protein-tyrosine phosphatase family and in the C-terminal section it belongs to the eukaryotic GTase family. It is a bifunctional 597-amino acid protein with RNA triphosphatase and RNA guanylyltransferase activities(PMID:9545288). It has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3105 Product name: Recombinant human RNGTT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-598 aa of BC019954 Sequence: TQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPHPLT Predict reactive species Full Name: RNA guanylyltransferase and 5'-phosphatase Calculated Molecular Weight: 597 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC019954 Gene Symbol: RNGTT Gene ID (NCBI): 8732 RRID: AB_2181385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60942 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.