Iright
BRAND / VENDOR: Proteintech

Proteintech, 12448-1-AP, RPA1 Polyclonal antibody

CATALOG NUMBER: 12448-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RPA1 (12448-1-AP) by Proteintech is a Polyclonal antibody targeting RPA1 in WB, ELISA applications with reactivity to human, mouse samples 12448-1-AP targets RPA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, Y79 cells, A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Replication protein A 1 (RPA1) is a subunit of a stable heterotrimer replication protein A (RPA), which is conserved in almost all eukaryotic species (PMID: 27151292). Usually, RPA1, RPA2 and RPA3 function as a whole to participate in DNA replication, telomere maintenance, DNA recombination, DNA repair, and activation of DNA damage checkpoints. In the cell, RPA has a higher affinity to bind single strand DNA and then to form a fork protection complex with other components such as PTEN and OTUB1, thus maintains genome stability during replication(PMID: 26403191; PMID: 18469000). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3067 Product name: Recombinant human RPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 317-616 aa of BC018126 Sequence: VDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM Predict reactive species Full Name: replication protein A1, 70kDa Calculated Molecular Weight: 616 aa, 68 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC018126 Gene Symbol: RPA1 Gene ID (NCBI): 6117 RRID: AB_2180495 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P27694 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924