Iright
BRAND / VENDOR: Proteintech

Proteintech, 12455-1-AP, EPS8 Polyclonal antibody

CATALOG NUMBER: 12455-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPS8 (12455-1-AP) by Proteintech is a Polyclonal antibody targeting EPS8 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 12455-1-AP targets EPS8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Epidermal growth factor receptor Pathway Substrate 8 (EPS8) is a crucial regulator of the actin cytoskeleton dynamics accompanying cell motility and invasion. This protein contains one PH domain and one SH3 domain leading to its binding activity with multiple cellular targets. EPS8 can function as a unique actin capping protein specifically required for dendritic cell migration and plays roles in the regulation of axonal filopodia in neuronal development and synapse formation. The EPS8 gene may contribute to the development of a subset of colorectal cancers and could have applications in diagnosis and treatment. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3121 Product name: Recombinant human EPS8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-267 aa of BC030010 Sequence: GMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARID Predict reactive species Full Name: epidermal growth factor receptor pathway substrate 8 Calculated Molecular Weight: 822 aa, 92 kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: BC030010 Gene Symbol: EPS8 Gene ID (NCBI): 2059 RRID: AB_2098836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12929 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924