Proteintech, 12456-1-AP, PDCD5 Polyclonal antibody

Size: 20ul / 150ul The PDCD5 (12456-1-AP) by Proteintech is a Polyclonal antibody targeting PDCD5 in WB, IHC, ELISA applications with reactivity to human samples 12456-1-AP targets PDCD5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human heart tissue, PC-3 cells, human brain tissue, A549 cells Positive IHC detected in: human endometrial cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PDCD5, also called TFAR19 (TF1 cell apoptosis-related gene 19), was first identified as a gene up-regulated in TF-1 cells under-going apoptosis (PMID: 9920759). PDCD5 can promote pro-grammed cell death in different cell types in response to various stimuli and also enhance TAJ/TROY-induced paraptosis-like cell death (PMID: 15020679). During apoptosis, PDCD5 is rapidly upregulated and translocates from the cytoplasm to nucleus (PMID: 11741587). PDCD5 is a positive regulator of Tip60 and also has a potential ability to interact with p53 (PMID: 22914926, PMID: 19308289). Recent studies have also revealed that PDCD5 may be a suppressor gene and expressed at lower levels in many cancers, including hepatocellular carcinoma, breast cancer, gastric cancer, cervical cancer, lung cancer, astrocytic gliomas, and in leukemia. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3122 Product name: Recombinant human PDCD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC015519 Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY Predict reactive species Full Name: programmed cell death 5 Calculated Molecular Weight: 125 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC015519 Gene Symbol: PDCD5 Gene ID (NCBI): 9141 RRID: AB_2162450 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14737 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.