Proteintech, 12483-1-AP, LGI1 Polyclonal antibody

Size: 20ul / 150ul The LGI1 (12483-1-AP) by Proteintech is a Polyclonal antibody targeting LGI1 in WB, ELISA applications with reactivity to human, mouse, rat samples 12483-1-AP targets LGI1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3184 Product name: Recombinant human LGI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 248-557 aa of BC022500 Sequence: EYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA Predict reactive species Full Name: leucine-rich, glioma inactivated 1 Calculated Molecular Weight: 557 aa, 64 kDa Observed Molecular Weight: 64 kDa, 58 kDa GenBank Accession Number: BC022500 Gene Symbol: LGI1 Gene ID (NCBI): 9211 RRID: AB_10637849 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95970 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.