Iright
BRAND / VENDOR: Proteintech

Proteintech, 12492-1-AP, BMP4 Polyclonal antibody

CATALOG NUMBER: 12492-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BMP4 (12492-1-AP) by Proteintech is a Polyclonal antibody targeting BMP4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12492-1-AP targets BMP4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BMP4, also named as BMP2B and DVR4, belongs to the TGF-beta family. BMPs have been shown to promote astroglial differentiation both in vitro and in vivo. BMP4 have been shown to be components of serum and are thought to be responsible for this differentiation. BMP4 are expressed mainly in neurons, with minimal expression detected in astrocytes and oligodendrocytes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3191 Product name: Recombinant human BMP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-408 aa of BC020546 Sequence: ASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEAISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR Predict reactive species Full Name: bone morphogenetic protein 4 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC020546 Gene Symbol: BMP4 Gene ID (NCBI): 652 RRID: AB_2063531 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12644 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924