Iright
BRAND / VENDOR: Proteintech

Proteintech, 12517-1-AP, GLIPR1 Polyclonal antibody

CATALOG NUMBER: 12517-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLIPR1 (12517-1-AP) by Proteintech is a Polyclonal antibody targeting GLIPR1 in WB, ELISA applications with reactivity to human, rat, pig samples 12517-1-AP targets GLIPR1 in WB, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, rat kidney tissue, pig kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information GLIPR1, also known as related to testis-specific, vespid, and pathogenesis protein 1 (RTVP-1), is a membrane protein that belongs to the CAP family of cysteine-rich secretory proteins. GLIPR1 is closely associated with the development of tumors, especially GM (8,9). The high expression of GLIPR1 was found in GM cells but not in tumors or other cells of the central nervous system. Specification Tested Reactivity: human, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3205 Product name: Recombinant human GLIPR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-240 aa of BC012510 Sequence: SNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV Predict reactive species Full Name: GLI pathogenesis-related 1 Calculated Molecular Weight: 266 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012510 Gene Symbol: GLIPR1 Gene ID (NCBI): 11010 RRID: AB_3669144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48060 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924