Product Description
Size: 20ul / 150ul
The MAP17 / PDZK1IP1 (12518-1-AP) by Proteintech is a Polyclonal antibody targeting MAP17 / PDZK1IP1 in IHC, IF/ICC, ELISA applications with reactivity to human samples
12518-1-AP targets MAP17 / PDZK1IP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: PC-3 cells
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
PDZK1-interacting protein 1(PDZK1IP1), also known as MAP17, is a membrane-associated protein. MAP17 / PDZK1IP1 is overexpressed in a variety of human carcinomas, and overexpression of MAP17 / PDZK1IP1 protein is strongly correlated with the progression of prostate and ovarian carcinomas (PMID: 17426052). MAP17 / PDZK1IP1 has been proven to be an oncogene for tumorigenesis and development of papillary thyroid cancer (PTC) (PMID: 36057192; PMID: 35727731).
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag3206 Product name: Recombinant human PDZK1IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-114 aa of BC012303 Sequence: VPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVKHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM Predict reactive species
Full Name: PDZK1 interacting protein 1
Calculated Molecular Weight: 114 aa, 12 kDa
GenBank Accession Number: BC012303
Gene Symbol: MAP17
Gene ID (NCBI): 10158
RRID: AB_3085395
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q13113
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924