Proteintech, 12530-1-AP, RRAS2 Polyclonal antibody

Size: 20ul / 150ul The RRAS2 (12530-1-AP) by Proteintech is a Polyclonal antibody targeting RRAS2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 12530-1-AP targets RRAS2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse pancreas tissue Positive IP detected in: NIH/3T3 cells Positive IHC detected in: mouse heart tissue, human heart tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Ras-related protein R-Ras2 (RRAS2) is also named TC21 and Teratocarcinoma oncogene. The RRAS2 member of the RAS-related subfamily, also known as TC21, is a close relative of the classic RAS GTPases (PMID: 3898776). RRAS2, a member of the R-Ras subfamily of Ras-like low-molecular-weight GTPases, is located in the plasma membrane and functions as a signal transducer (PMID: 38601074). RRAS2 is GTP-binding protein with GTPase activity, involved in the regulation of MAPK signaling pathway and thereby controlling multiple cellular processes (PMID: 31130282). Specification Tested Reactivity: human, mouse Cited Reactivity: human, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3226 Product name: Recombinant human RRAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC013106 Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF Predict reactive species Full Name: related RAS viral (r-ras) oncogene homolog 2 Calculated Molecular Weight: 204 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC013106 Gene Symbol: RRAS2 Gene ID (NCBI): 22800 RRID: AB_2180206 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62070 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.