Proteintech, 12545-1-AP, PEX5 Polyclonal antibody

Size: 20ul / 150ul The PEX5 (12545-1-AP) by Proteintech is a Polyclonal antibody targeting PEX5 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 12545-1-AP targets PEX5 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, human brain tissue, human kidney tissue, L02 cells, mouse kidney tissue, mouse brain tissue, rat brain tissue Positive IP detected in: Raji cells, mouse kidney tissue Positive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information The peroxisomal targeting signal type1 (PTS1) receptor, PEX5, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively, and PEX5 binds PTS1 through its C-terminal 40-kDa tetratricopeptide repeat domain. It is a predominantly cytoplasmic, partly peroxisomal protein that appears to shuttle between these compartments as it mediates the import of PTS1-containing proteins. PEX5 has been reported to interact with PEX10, PEX12, PEX13, and PEX14. Defects in PEX5 are a cause of Zellweger syndrome (ZWS), which is a lethal peroxisome biogenesis disorder. This antibody recognizes endogenous PEX5, which migrates with an apparent molecular mass of 80 kDa (PMID: 7790377). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3268 Product name: Recombinant human PEX5 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 340-639 aa of BC010621 Sequence: EGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ Predict reactive species Full Name: peroxisomal biogenesis factor 5 Calculated Molecular Weight: 631 aa, 70 kDa Observed Molecular Weight: 68-80 kDa GenBank Accession Number: BC010621 Gene Symbol: PEX5 Gene ID (NCBI): 5830 RRID: AB_2268102 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50542 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.