Iright
BRAND / VENDOR: Proteintech

Proteintech, 12558-1-AP, Neuroserpin Polyclonal antibody

CATALOG NUMBER: 12558-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Neuroserpin (12558-1-AP) by Proteintech is a Polyclonal antibody targeting Neuroserpin in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 12558-1-AP targets Neuroserpin in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: rat brain tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system, such as s the cerebral cortex, hippocampus and the spinal cord.Neuroserpin exerts protective effects in neurons against excitotoxicity both in vitro and in vivo. Its proteolytic inhibitory activity is shown to protect neurons against damage caused by plasmin activation. Mice overexpressing neuroserpin exhibited loss of tPA activity in the brain. Overexpression of neuroserpin in primary neurons leads to increased dendritic arborization and altered dendritic spine shape. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3275 Product name: Recombinant human SERPINI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 109-410 aa of BC018043 Sequence: ANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL Predict reactive species Full Name: serpin peptidase inhibitor, clade I (neuroserpin), member 1 Calculated Molecular Weight: 410 aa, 47 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC018043 Gene Symbol: Neuroserpin Gene ID (NCBI): 5274 RRID: AB_10642703 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99574 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924