Proteintech, 12560-1-AP, FUT8 Polyclonal antibody

Size: 20ul / 150ul The FUT8 (12560-1-AP) by Proteintech is a Polyclonal antibody targeting FUT8 in WB, IHC, ELISA applications with reactivity to human, mouse samples 12560-1-AP targets FUT8 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse cerebellum tissue Positive IHC detected in: human stomach cancer tissue, human lung cancer tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Fucosyltransferase 8 (FUT8) is GDP-fucose-glycoprotein fucosyltransferase and is localized in Golgi apparatus. FUT8 is involved in protein glycosylation by catalyzing the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans. FUT8 may be involved in human aging by regulating protein N-glycosylation and in the molecular pathogenesis of human pulmonary emphysema (PE). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3280 Product name: Recombinant human FUT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-575 aa of BC025385 Sequence: HWSGEVKDKNVQVVEFPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK Predict reactive species Full Name: fucosyltransferase 8 (alpha (1,6) fucosyltransferase) Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 66-70 kDa GenBank Accession Number: BC025385 Gene Symbol: FUT8 Gene ID (NCBI): 2530 RRID: AB_2294158 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYC5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.