Iright
BRAND / VENDOR: Proteintech

Proteintech, 12563-1-AP, PBRM1 Polyclonal antibody

CATALOG NUMBER: 12563-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PBRM1 (12563-1-AP) by Proteintech is a Polyclonal antibody targeting PBRM1 in WB, ELISA applications with reactivity to human, mouse, rat samples 12563-1-AP targets PBRM1 in WB, IP, Dot blot, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PBRM1, also named hPB1 BAF180 and Polybromo-1D, acts as a negative regulator of cell proliferation. PBRM1 is the second major mutated clear cell RCC cancer gene after VHL. PBRM1 loss is associated with low grade features. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3148 Product name: Recombinant human PBRM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-306 aa of BC015323 Sequence: MGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEGMMGGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIRQAYNLENV Predict reactive species Full Name: polybromo 1 Calculated Molecular Weight: 180 kDa Observed Molecular Weight: 180-195 kDa, 100 kDa GenBank Accession Number: BC015323 Gene Symbol: PBRM1 Gene ID (NCBI): 55193 RRID: AB_2877865 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86U86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924