Iright
BRAND / VENDOR: Proteintech

Proteintech, 12569-1-AP, SCFD1 Polyclonal antibody

CATALOG NUMBER: 12569-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCFD1 (12569-1-AP) by Proteintech is a Polyclonal antibody targeting SCFD1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12569-1-AP targets SCFD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, human kidney tissue, human liver tissue, HEK-293 cells, HeLa cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SCFD1, also named as C14orf163, KIAA0917, STXBP1L2, Sly1p and SLY1, belongs to the STXBP/unc-18/SEC1 family. It is a component of the syntaxin-5 SNARE complex which regulates the early secretory pathway of eukaryotic cells at the level of endoplasmic reticulum (ER) to Golgi transport.(PMID:21242315) SCFD1 plays a role in SNARE-pin assembly and Golgi-to-ER retrograde transport via its interaction with COG4. It is involved in vesicular transport between the endoplasmic reticulum and the Golgi. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, bacteria Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3234 Product name: Recombinant human SCFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 342-642 aa of BC017734 Sequence: QQELESYRAQEDEVKRLKSIMGLEGEDEGAISMLSDNTAKLTSAVSSLPELLEKKRLIDLHTNVATAVLEHIKARKLDVYFEYEEKIMSKTTLDKSLLDIISDPDAGTPEDKMRLFLIYYISTQQAPSEADLEQYKKALTDAGCNLNPLQYIKQWKAFTKMASAPASYGSTTTKPMGLLSRVMNTGSQFVMEGVKNLVLKQQNLPVTRILDNLMEMKSNPETDDYRYFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGKHILYGCSELFNATQFIKQLSQLGQK Predict reactive species Full Name: sec1 family domain containing 1 Calculated Molecular Weight: 642 aa, 72 kDa Observed Molecular Weight: 66-72 kDa GenBank Accession Number: BC017734 Gene Symbol: SCFD1 Gene ID (NCBI): 23256 RRID: AB_2183266 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924