Iright
BRAND / VENDOR: Proteintech

Proteintech, 12572-1-AP, EPAC1 Polyclonal antibody

CATALOG NUMBER: 12572-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPAC1 (12572-1-AP) by Proteintech is a Polyclonal antibody targeting EPAC1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, hamster samples 12572-1-AP targets EPAC1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, hamster samples. Tested Applications Positive WB detected in: CHO cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information EPAC1 functions as a guanine nucleotide exchange factor (GEF), activating small GTPases like Rap1 and Rap2, leading to diverse cellular response. Epac proteins are cAMP sensors that regulate several pivotal cellular processes, including calcium handling, cell proliferation, cell survival, cell differentiation, cell polarization, cell adhesion events, gene transcription, secretion, ion transport, and neuronal signaling. It is a potential target for therapeutic intervention, such as metabolic disorders, cardiovascular diseases (PMID: 20007405, PMID: 20421979). EPAC1 also enhances brown fat growth and beige adipogenesis (PMID: 38195707). Specification Tested Reactivity: human, mouse, rat, hamster Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3240 Product name: Recombinant human RAPGEF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 441-788 aa of BC017728 Sequence: HFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALE Predict reactive species Full Name: Rap guanine nucleotide exchange factor (GEF) 3 Calculated Molecular Weight: 881 aa, 99 kDa Observed Molecular Weight: 99-104 kDa GenBank Accession Number: BC017728 Gene Symbol: EPAC1/RAPGEF3 Gene ID (NCBI): 10411 RRID: AB_11232407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95398 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924