Proteintech, 12580-1-AP, EDIL3 Polyclonal antibody

Size: 20ul / 150ul The EDIL3 (12580-1-AP) by Proteintech is a Polyclonal antibody targeting EDIL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12580-1-AP targets EDIL3 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, COLO 320 cells, mouse brain tissue, HepG2 cells, mouse lung tissue, human lung tissue, HeLa cells, K-562 cells Positive IHC detected in: human pancreas cancer tissue, human lung cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information EGF-like repeats and discoidin I-like domain-containing protein 3 (EDIL3), also named as DEL1 or integrin-biding protein DEL1, is a 52-kDa extracellular matrix protein produced by endothelial cells in embryos (PMID: 9420328). It is composed of three EGF repeats and two discoidin I-like domains. The second EGF repeat contains an RGD motif. EDIL3 promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. It may be involved in vascular remodeling during angiogenesis (PMID: 12840057; 14981004). EDIL3 has also been reported to be an endogenous inhibitor of inflammatory cell recruitment by interfering with the integrin LFA-1-dependent leukocyte-endothelial adhesion (PMID: 19008446). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3274 Product name: Recombinant human EDIL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-480 aa of BC030828 Sequence: GGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE Predict reactive species Full Name: EGF-like repeats and discoidin I-like domains 3 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 52-55 kDa GenBank Accession Number: BC030828 Gene Symbol: EDIL3 Gene ID (NCBI): 10085 RRID: AB_2096219 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43854 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.