Proteintech, 12583-1-AP, ARHGAP29 Polyclonal antibody

Size: 20ul / 150ul The ARHGAP29 (12583-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP29 in WB, IHC, ELISA applications with reactivity to human samples 12583-1-AP targets ARHGAP29 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3282 Product name: Recombinant human ARHGAP29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC022483 Sequence: MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEVNEENKNDLFQEVFSSIETLAFTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESVDSSSEKGNFSPLELDNVLLKNTDSIE Predict reactive species Full Name: Rho GTPase activating protein 29 Calculated Molecular Weight: 142 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC022483 Gene Symbol: ARHGAP29 Gene ID (NCBI): 9411 RRID: AB_2918030 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q52LW3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.