Iright
BRAND / VENDOR: Proteintech

Proteintech, 12588-1-AP, CRABP1 Polyclonal antibody

CATALOG NUMBER: 12588-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRABP1 (12588-1-AP) by Proteintech is a Polyclonal antibody targeting CRABP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12588-1-AP targets CRABP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse embryo tissue, human spleen tissue, Transfected HEK-293 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The cellular retinoic acid-binding proteins including CRABP1 and CRABP2 bind retinoic acid (RA), an important regulator of cell growth and differentiation, thus play an important role in RA-mediated differentiation and proliferation processes. It has been reported that CRABP1 influences the biological effects of RA in cell-selective manners by enhancing the physiological function of RA in keratinocytes or inhibiting RA-induced differentiation of neuroblastoma cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rabbit, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3291 Product name: Recombinant human CRABP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC022069 Sequence: MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTSELANDELILTFGADDVVCTRIYVRE Predict reactive species Full Name: cellular retinoic acid binding protein 1 Calculated Molecular Weight: 137 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC022069 Gene Symbol: CRABP1 Gene ID (NCBI): 1381 RRID: AB_2292271 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29762 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924