Proteintech, 12591-1-AP, AKAP7 Polyclonal antibody

Size: 20ul / 150ul The AKAP7 (12591-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP7 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12591-1-AP targets AKAP7 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human brain tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information AKAP7, also named as AKAP15 and AKAP18, localize PKA in complexes with CaV1.2 and PLN, respectively. AKAP7 targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. AKAP7 has short isoform AKAP7 alpha and AKAP7 beta with MW 15-18 kDa; long isoform AKAP7 gamma with MW 37-42 kDa. AKAP7alpha was highly expressed only in brain and weakly in lung lysates from WT animals. This antibody can recognize all the isoforms of AKAP7. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3297 Product name: Recombinant human AKAP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC016927 Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK Predict reactive species Full Name: A kinase (PRKA) anchor protein 7 Calculated Molecular Weight: 81 aa, 9 kDa Observed Molecular Weight: 11 kDa, 18 kDa, 37 kDa GenBank Accession Number: BC016927 Gene Symbol: AKAP7 Gene ID (NCBI): 9465 RRID: AB_2226037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.