Proteintech, 12604-1-AP, IFIT2 Polyclonal antibody

Size: 20ul / 150ul The IFIT2 (12604-1-AP) by Proteintech is a Polyclonal antibody targeting IFIT2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 12604-1-AP targets IFIT2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, THP-1 cells Positive IP detected in: A431 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IFIT2 belongs to the IFIT family. It contains 6 TPR repeats. IFIT genes comprise a large family with three (Ifit1, Ifit2, and Ifit3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT proteins are produced in human body that are supposed to confer immunity against viral infection. These proteins are generally produced during viral infection, IFN treatment, and during pathogen recognition (Pathogen associated molecular pattern recognition) by immune system during infections. Specification Tested Reactivity: human Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3283 Product name: Recombinant human IFIT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-399 aa of BC032839 Sequence: ATMCNLLAYLKHLKGQNEAALECLRKAEELIQQEHADQAEIRSLVTWGNYAWVYYHMGRLSDVQIYVDKVRHVCEKFSSPYRIESPELDCEEGWTRLKCGGNQNERAKVCFEKALEKKPKNPEFTSGLAIASYRLDNWPPSQNAIDPLRQAIRLNPDNQYLKVLLALKLHKMREEGEEEGEGEKLVEEALEKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYIPNNAYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEEAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGV Predict reactive species Full Name: IFIT 2 Calculated Molecular Weight: 484 aa, 56 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC032839 Gene Symbol: IFIT2 Gene ID (NCBI): 3433 RRID: AB_2864734 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09913 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.