Iright
BRAND / VENDOR: Proteintech

Proteintech, 12619-1-AP, MICA Polyclonal antibody

CATALOG NUMBER: 12619-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MICA (12619-1-AP) by Proteintech is a Polyclonal antibody targeting MICA in WB, ELISA applications with reactivity to human samples 12619-1-AP targets MICA in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, SH-SY5Y cells, U266 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Human MHC class I chain-related genes located within the HLA class I region of chromosome 6 encode MHC class I chain-related A and B (MICA and MICB) (PMID: 11429322). MICA and MICB are stress-inducible surface molecules that are not associated with β2-microglobulin and do not present peptides (PMID: 9497295). They are expressed in intestinal epithelium and many epithelial tumors (PMID: 10359807). MICA and MICB are ligands for NKG2D which is an activating receptor that is expressed on most natural killer (NK) cells, CD8 αβ T cells, and γδ T cells (PMID: 10426993; 11491531). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3298 Product name: Recombinant human MICA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-383 aa of BC016929 Sequence: SWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGT Predict reactive species Full Name: MHC class I polypeptide-related sequence A Calculated Molecular Weight: 383 aa, 43 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC016929 Gene Symbol: MICA Gene ID (NCBI): 100507436 RRID: AB_10638612 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q29983 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924