Iright
BRAND / VENDOR: Proteintech

Proteintech, 12627-1-AP, SUCLA2 Polyclonal antibody

CATALOG NUMBER: 12627-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SUCLA2 (12627-1-AP) by Proteintech is a Polyclonal antibody targeting SUCLA2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12627-1-AP targets SUCLA2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells, SH-SY5Y cells, HepG2 cells, PC-3 cells, mouse brain tissue, mouse liver tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissue, human heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SUCLA2, β subunit of succinate-CoA ligase, contributes to energy production in mitochondria through the succinate-CoA ligase enzyme. Succinate-CoA ligase catalyses the reversible conversion of succinyl-CoA and ADP or GDP to succinate and ATP or GTP. SUCLA2 mutations cause global protein succinylation and mitochondrial DNA depletion (PMID: 33230181, PMID: 20301762). Mutations in SUCLA2 are also associated with SUCLA2-related mitochondrial DNA depletion syndrome, leigh syndrome, down syndrome (PMID: 23010432). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3319 Product name: Recombinant human SUCLA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-353 aa of BC027587 Sequence: AQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERDKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGAT Predict reactive species Full Name: succinate-CoA ligase, ADP-forming, beta subunit Calculated Molecular Weight: 463 aa, 50 kDa Observed Molecular Weight: 48-50 kDa GenBank Accession Number: BC027587 Gene Symbol: SUCLA2 Gene ID (NCBI): 8803 RRID: AB_2271200 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2R7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924