Proteintech, 12632-1-AP, LAMP3 Polyclonal antibody

Size: 20ul / 150ul The LAMP3 (12632-1-AP) by Proteintech is a Polyclonal antibody targeting LAMP3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12632-1-AP targets LAMP3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, mouse thymus tissue, rat lung tissue, A549 cells, HEK-293T cells, Raji cells Positive IP detected in: A549 cells Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LAMP3 (lysosome-associated membrane protein 3), also known as DC-LAMP (DC-lysosome-associated membrane glycoprotein), TSC403 or CD208, is a highly glycosylated lysosomal membrane protein that belongs to the LAMP family. The mature glycoprotein has an apparent molecular mass of 70-90 kDa, which is considerably larger than its predicted mass of 44 kDa (PMID: 9768752). LAMP3 is expressed in lung type II pneumocytes, lymphoid organs and dendritic cells. It might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 mRNA is up-regulated in some human cancers (PMID:9721848). LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer (PMID: 16204031). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3325 Product name: Recombinant human LAMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-380 aa of BC032940 Sequence: FPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDY Predict reactive species Full Name: lysosomal-associated membrane protein 3 Calculated Molecular Weight: 416 aa, 44 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC032940 Gene Symbol: LAMP3 Gene ID (NCBI): 27074 RRID: AB_2076629 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.