Iright
BRAND / VENDOR: Proteintech

Proteintech, 12634-1-AP, DIRAS1 Polyclonal antibody

CATALOG NUMBER: 12634-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DIRAS1 (12634-1-AP) by Proteintech is a Polyclonal antibody targeting DIRAS1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 12634-1-AP targets DIRAS1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human brain tissue, human placenta tissue, MCF-7 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DIRAS1 belongs to the small guanosine triphosphatase (GTPase) Ras superfamily. DIRAS1 is frequently downregulated in human cancers due to DNA copy number loss, loss of heterozygosity (LOH), and hypermethylation of the promoter. The restoration of DIRAS1 has been reported to suppress tumor growth and metastasis in human neural tumors, esophageal cancer, colorectal cancer, and ovarian cancer. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3329 Product name: Recombinant human DIRAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC030660 Sequence: MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM Predict reactive species Full Name: DIRAS family, GTP-binding RAS-like 1 Calculated Molecular Weight: 198 aa, 22 kDa Observed Molecular Weight: 22-24 kDa GenBank Accession Number: BC030660 Gene Symbol: DIRAS1 Gene ID (NCBI): 148252 RRID: AB_2292771 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95057 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924