Proteintech, 12665-1-AP, INPP4A Polyclonal antibody

Size: 20ul / 150ul The INPP4A (12665-1-AP) by Proteintech is a Polyclonal antibody targeting INPP4A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12665-1-AP targets INPP4A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Inositol polyphosphate 4 phosphatase (INPP4A) belongs to the group of phosphoinositide phosphatases controlling proliferation, apoptosis, and endosome function by hydrolyzing phosphatidylinositol 3,4-bisphosphate. INPP4A is highly expressed in the central nervous system, which is shown to play a key role in glutamate excitotoxicity and cell proliferation. (PMID: 36653678, PMID: 31938306) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3346 Product name: Recombinant human INPP4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC028361 Sequence: MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSLDRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDGNHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEELGELSPCWESLRRQIVTQYQTI Predict reactive species Full Name: inositol polyphosphate-4-phosphatase, type I, 107kDa Calculated Molecular Weight: 972 aa, 109 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC028361 Gene Symbol: INPP4A Gene ID (NCBI): 3631 RRID: AB_3669147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.