Proteintech, 12673-1-AP, BRSK1 Polyclonal antibody

Size: 20ul / 150ul The BRSK1 (12673-1-AP) by Proteintech is a Polyclonal antibody targeting BRSK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12673-1-AP targets BRSK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse stomach tissue, human ovary tumor tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information BRSK1(Brain-specific serine/threonine-protein kinase 1) is also named as KIAA1811, SAD1, SADB and belongs to the SNF1 subfamily. BRSKs are crucial for establishing neuronal polarity, and BRSK1 has also been shown to regulate neurotransmitter release presynaptically. BRSK1 is a serine-threonine kinases specifically expressed in the brain, and activated by LKB1-mediated phosphorylation of a threonine residue at their T-loop. (PMID:22020259). It has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3357 Product name: Recombinant human BRSK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 475-778 aa of BC016681 Sequence: TQTLPSRGPRGGGAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELSSSPRRAPPKDKKLLATNGTPLP Predict reactive species Full Name: BR serine/threonine kinase 1 Calculated Molecular Weight: 87 kDa Observed Molecular Weight: 85-90 kDa GenBank Accession Number: BC016681 Gene Symbol: BRSK1 Gene ID (NCBI): 84446 RRID: AB_2274933 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.