Iright
BRAND / VENDOR: Proteintech

Proteintech, 12678-1-AP, GLIS3 Polyclonal antibody

CATALOG NUMBER: 12678-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLIS3 (12678-1-AP) by Proteintech is a Polyclonal antibody targeting GLIS3 in WB, ELISA applications with reactivity to human, mouse, rat samples 12678-1-AP targets GLIS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, A549 cells, BxPC-3 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. GLIS3 (gLIS family zinc finger 3), also known as ZNF515 that localizes to the nucleus and contains five C2H2-type zinc fingers. Expressed in a variety of tissues, including kidney, brain, liver, lung, ovary, pancreas, thymus and skeletal muscle, GLIS3 functions as both an activator and a suppressor of transcription, specifically binding the consensus sequence 5'-GACCACCCAC-3' through its C2H2-type zinc fingers. Defects in the gene encoding GLIS3 are a cause of NDH syndrome; a neonatal diabetes that is characterized by congenital hypothyroidism, congenital glaucoma, hepatic fibrosis and polycystic kidneys. There are various isoform of GLIS3 and molecular weight of one isoform is 70 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3366 Product name: Recombinant human GLIS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 429-775 aa of BC033899 Sequence: LKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQQARKKLRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSSNYSSRSGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVPSFEDCLVPTSMGQASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSSVYTEG Predict reactive species Full Name: GLIS family zinc finger 3 Calculated Molecular Weight: 775 aa, 84 kDa Observed Molecular Weight: 70-85 kDa GenBank Accession Number: BC033899 Gene Symbol: GLIS3 Gene ID (NCBI): 169792 RRID: AB_2877873 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924