Iright
BRAND / VENDOR: Proteintech

Proteintech, 12699-1-AP, SGK3 Polyclonal antibody

CATALOG NUMBER: 12699-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SGK3 (12699-1-AP) by Proteintech is a Polyclonal antibody targeting SGK3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12699-1-AP targets SGK3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A375 cells, human liver tissue, mouse skin tissue, rat kidney tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human pancreas cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Serum- and glucocorticoid-inducible kinase 3 (SGK3) is a protein kinase of the AGC family of protein kinase A, protein kinase G, and protein kinase C and functions downstream of phosphatidylinositol 3-kinase (PI3K)(PMID:21084382). It is also named as DKFZp781N0293, CISK, SGK2, SGKL and may be involved in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. SGK3 mediates cell IL-3-dependent survival signals (PMID:12397388). SGK3 has 2 isoforms produced by alternative splicing with the molecular weight of 57 kDa and 53 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3149 Product name: Recombinant human SGK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-496 aa of BC015326 Sequence: TDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL Predict reactive species Full Name: serum/glucocorticoid regulated kinase family, member 3 Calculated Molecular Weight: 496 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC015326 Gene Symbol: SGK3 Gene ID (NCBI): 23678 RRID: AB_2188548 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53EW6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924