Iright
BRAND / VENDOR: Proteintech

Proteintech, 12705-1-AP, TRAM1 Polyclonal antibody

CATALOG NUMBER: 12705-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAM1 (12705-1-AP) by Proteintech is a Polyclonal antibody targeting TRAM1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12705-1-AP targets TRAM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, Jurkat cells, PC-3 cells Positive IP detected in: mouse pancreas tissue Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3384 Product name: Recombinant human TRAM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 310-374 aa of BC037738 Sequence: FMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS Predict reactive species Full Name: translocation associated membrane protein 1 Calculated Molecular Weight: 374 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC037738 Gene Symbol: TRAM1 Gene ID (NCBI): 23471 RRID: AB_2282651 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15629 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924