Iright
BRAND / VENDOR: Proteintech

Proteintech, 12730-1-AP, VASH1 Polyclonal antibody

CATALOG NUMBER: 12730-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VASH1 (12730-1-AP) by Proteintech is a Polyclonal antibody targeting VASH1 in WB, IF/ICC, ELISA applications with reactivity to human samples 12730-1-AP targets VASH1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, HeLa cells, MCF-7 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information VASH1, also named as vasohibin 1, is a angiogenesis inhibitor induced by the stimulation with VEGF. High expression of VASH1 has been researched in some tumors as a result of VEGF induction. It has been suggested that VASH-1 is clinically significant in bladder cancer, colorectal cancer and NSCLC. VASH-1 may be a potential marker of gastric cancer and a target for vascular targeting therapy. 12730-1-AP detects 41 kDa form secreted protein and 36 kDa form protein accumulated within the cells or pericellular milieu in SDS-PAGE.(PMID:19057892, 29042936, 29552154, 26666821) Specification Tested Reactivity: human Cited Reactivity: mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3435 Product name: Recombinant human VASH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC009031 Sequence: MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG Predict reactive species Full Name: vasohibin 1 Calculated Molecular Weight: 365 aa, 41 kDa Observed Molecular Weight: 36 and 41 kDa GenBank Accession Number: BC009031 Gene Symbol: VASH1 Gene ID (NCBI): 22846 RRID: AB_2288318 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L8A9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924