Proteintech, 12775-1-AP, MEIS3 Polyclonal antibody

Size: 20ul / 150ul The MEIS3 (12775-1-AP) by Proteintech is a Polyclonal antibody targeting MEIS3 in WB, ELISA applications with reactivity to human, mouse, rat samples 12775-1-AP targets MEIS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, A549 cells, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MEIS3, also known as MRG2, belongs to the TALE/MEIS homeobox family. MEIS3 encodes a homeobox domain, so it can bind to DNA, regulate specific DNA sequence binding, and promote transcription activity. MEIS3 has 3 isoforms with the molecular mass of 39, 41, and 46 kDa (PMID: PMID: 33376716). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3471 Product name: Recombinant human MEIS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 76-421 aa of BC025404 Sequence: CELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL Predict reactive species Full Name: Meis homeobox 3 Calculated Molecular Weight: 421 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC025404 Gene Symbol: MEIS3 Gene ID (NCBI): 56917 RRID: AB_10639519 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.