Iright
BRAND / VENDOR: Proteintech

Proteintech, 12789-1-AP, human BCL2 Polyclonal antibody

CATALOG NUMBER: 12789-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The human BCL2 (12789-1-AP) by Proteintech is a Polyclonal antibody targeting human BCL2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 12789-1-AP targets human BCL2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, Jurkat cells, HEK-293 cells, HL-60 cells, U-251 cells, U-937 cells, MCF-7 cells, U2OS cells Positive IP detected in: HL-60 cells, HepG2 cells, MCF-7 cells Positive IHC detected in: human tonsillitis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Positive FC (Intra) detected in: Jurkat cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information 1. What is Bcl-2?Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.2. FAQs for Bcl-2a. How to measure Bcl-2 and Bax apoptotic markers by western blottingGenerally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.b. What band size should I expect in western blotting for Bcl-2?The molecular weight of Bcl-2 is 26 kDa. Specification Tested Reactivity: human Cited Reactivity: human, rabbit, chicken, zebrafish, hamster, sheep, goat, fish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3508 Product name: Recombinant human BCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC027258 Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species Full Name: B-cell CLL/lymphoma 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC027258 Gene Symbol: BCL2 Gene ID (NCBI): 596 RRID: AB_2227948 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10415 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924