Proteintech, 12804-1-AP, VPS26A Polyclonal antibody

Size: 20ul / 150ul The VPS26A (12804-1-AP) by Proteintech is a Polyclonal antibody targeting VPS26A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12804-1-AP targets VPS26A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HEK-293 cells, rat kidney tissue Positive IHC detected in: human breast cancer tissue, human cervical cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information In mammals, there are two paralogues of yeast Vps26, VPS26A and VPS26B (PMID: 16190980). VPS26 is a component of the retromer complex composed of VPS26 (VPS26A or VPS26B), VPS29, VPS35, SNX1, and SNX2. VPS26A and VPS26B subunits define distinct retromer complexes (PMID: 21920005). The retromer complex is important in recycling transmembrane receptors from endosomes to the trans-Golgi network (TGN). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3391 Product name: Recombinant human VPS26A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-327 aa of BC022505 Sequence: LFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM Predict reactive species Full Name: vacuolar protein sorting 26 homolog A (S. pombe) Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC022505 Gene Symbol: VPS26A Gene ID (NCBI): 9559 RRID: AB_2215033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75436 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.