Iright
BRAND / VENDOR: Proteintech

Proteintech, 12810-1-AP, ARNT2 Polyclonal antibody

CATALOG NUMBER: 12810-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARNT2 (12810-1-AP) by Proteintech is a Polyclonal antibody targeting ARNT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12810-1-AP targets ARNT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, Raji cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Aryl-hydrocarbon receptor nuclear translocator 2(ARNT2), is a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. It specifically recognizes the xenobiotic response element(XRE). ARNT2 plays an important role in normal glucose handling in pancreatic beta cell function in humans and mice. ARNT2 proteins are dimeric partners for other PAS proteins such as HIF and SIM. ARNT2 and the other ARNT family members, e.g., ARNT, hypoxin inducible factor 1α (HIF1α), HIF2α, and aryl hydrocarbon receptor (AhR), are thought to function as heterodimers, and regulate the expression, and thereby the function, of many genes. Under hypoxic conditions, it complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. Modulation of ARNT2 in pancreatic beta cells affects glucose stimulated INS secretion (GSIS). This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human ARNT2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3536 Product name: Recombinant human ARNT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 363-716 aa of BC036099 Sequence: QDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPGNEWWSPHSRQHFRQPISYARM Predict reactive species Full Name: aryl-hydrocarbon receptor nuclear translocator 2 Calculated Molecular Weight: 716 aa, 79 kDa Observed Molecular Weight: 80-85 kDa GenBank Accession Number: BC036099 Gene Symbol: ARNT2 Gene ID (NCBI): 9915 RRID: AB_2059456 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924