Iright
BRAND / VENDOR: Proteintech

Proteintech, 12812-1-AP, TSPAN12 Polyclonal antibody

CATALOG NUMBER: 12812-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPAN12 (12812-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN12 in WB, ELISA applications with reactivity to human, mouse, rat samples 12812-1-AP targets TSPAN12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TSPAN12 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN12 regulates retinal vascular development by promoting Norrin/beta-catenin signaling (PMID: 19837033 ). Mutations in TSPAN12 are a relatively frequent cause of familial exudative vitreoretinopathy (FEVR) (PMID: 20159111). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3514 Product name: Recombinant human TSPAN12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-224 aa of BC031265 Sequence: GVWTYEQELMVPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLR Predict reactive species Full Name: tetraspanin 12 Calculated Molecular Weight: 305 aa, 35 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC031265 Gene Symbol: TSPAN12 Gene ID (NCBI): 23554 RRID: AB_2208667 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95859 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924