Proteintech, 12827-1-AP, MAP4K5 Polyclonal antibody

Size: 20ul / 150ul The MAP4K5 (12827-1-AP) by Proteintech is a Polyclonal antibody targeting MAP4K5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12827-1-AP targets MAP4K5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse ovary tissue, HeLa cells, K-562 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3547 Product name: Recombinant human MAP4K5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-274 aa of BC036013 Sequence: LRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTH Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase kinase 5 Calculated Molecular Weight: 846 aa, 95 kDa Observed Molecular Weight: 58 kDa, 95 kDa, 120 kDa GenBank Accession Number: BC036013 Gene Symbol: MAP4K5 Gene ID (NCBI): 11183 RRID: AB_2140986 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4K4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.