Iright
BRAND / VENDOR: Proteintech

Proteintech, 12841-1-AP, CENPH Polyclonal antibody

CATALOG NUMBER: 12841-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CENPH (12841-1-AP) by Proteintech is a Polyclonal antibody targeting CENPH in WB, IP, ELISA applications with reactivity to human, mouse samples 12841-1-AP targets CENPH in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Centromere protein H (CENPH) is a component of the active centromere complex that associates with centromeric DNA and binds spindle microtubules to the chromosomes, which is required for chromosome congression and efficiently align the chromosomes on a metaphase plate. CENPH plays a key role in assembly of kinetochore proteins, mitotic progression and chromosome segregation that may cause misaligned chromosomes and multipolar spindles. Besides, CENPH may be associated with the modulation of the cell cycle through an interaction with CENPC. It has been shown that the expression of CENPH is related to clinical application including colorectal cancer, gastric cancer, renal cell carcinoma, hepatocellular carcinoma and other poor prognosis in various solid tumors. (PMID: 26378239, 27993978, 28819418) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3836 Product name: Recombinant human CENPH protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-247 aa of BC015355 Sequence: MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM Predict reactive species Full Name: centromere protein H Calculated Molecular Weight: 247 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC015355 Gene Symbol: CENPH Gene ID (NCBI): 64946 RRID: AB_2076634 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3R5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924