Iright
BRAND / VENDOR: Proteintech

Proteintech, 12897-1-AP, GALNT4 Polyclonal antibody

CATALOG NUMBER: 12897-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GALNT4 (12897-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT4 in WB, IHC, ELISA applications with reactivity to human samples 12897-1-AP targets GALNT4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GALNT4 is a member of N-acetylgalactosaminyltransferases (GALNTs) which are responsible for initiating step of mucin-type O-glycosylation. Desregulation of GALNTs expression can exert pivotal functions during malignant transformation. It has been reported that GALNT4 expression is markedly repressed in tumoral tissues and lower expression of GALNT4 is significant associated with the adverse survival, indicating its potential role as prognostic factor for cancers like hepatocellular carcinoma. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3590 Product name: Recombinant human GALNT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-578 aa of BC036390 Sequence: CECNSGWLEPLLERIGRDETAVVCPVIDTIDWNTFEFYMQIGEPMIGGFDWRLTFQWHSVPKQERDRRISRIDPIRSPTMAGGLFAVSKKYFQYLGTYDTGMEVWGGENLELSFRVWQCGGKLEIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDISERKLLRERLRCKSFDWYLKNVFPNLHVPEDRPGWHGAIRSRGISSECLDYNSPDNNPTGANLSLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDALDKNQIWSFEK Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 4 (GalNAc-T4) Calculated Molecular Weight: 578 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC036390 Gene Symbol: GALNT4 Gene ID (NCBI): 8693 RRID: AB_10643389 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N4A0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924