Proteintech, 12900-1-AP, RCAN2 Polyclonal antibody

Size: 20ul / 150ul The RCAN2 (12900-1-AP) by Proteintech is a Polyclonal antibody targeting RCAN2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12900-1-AP targets RCAN2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RCAN2 is a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3597 Product name: Recombinant human RCAN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-201 aa of BC038509 Sequence: LFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAAC Predict reactive species Full Name: regulator of calcineurin 2 Calculated Molecular Weight: 225 aa, 25 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC038509 Gene Symbol: RCAN2 Gene ID (NCBI): 10231 RRID: AB_10638913 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14206 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.