Iright
BRAND / VENDOR: Proteintech

Proteintech, 12920-1-AP, BVES Polyclonal antibody

CATALOG NUMBER: 12920-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BVES (12920-1-AP) by Proteintech is a Polyclonal antibody targeting BVES in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12920-1-AP targets BVES in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information BVES, also named as POP1, POPDC1 and hBVES, belongs to the popeye family. It is cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. It is involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. It is also involved in striated muscle regeneration and repair and in the regulation of cell spreading. BVES is expressed in the progenitors of coronary artery smooth muscle cells as well as in differentiated smooth muscle cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3593 Product name: Recombinant human BVES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-360 aa of BC034425 Sequence: LYKKRPVKIEKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP Predict reactive species Full Name: blood vessel epicardial substance Calculated Molecular Weight: 360 aa, 41 kDa Observed Molecular Weight: 41-70 kDa GenBank Accession Number: BC034425 Gene Symbol: BVES Gene ID (NCBI): 11149 RRID: AB_10640584 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NE79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924