Iright
BRAND / VENDOR: Proteintech

Proteintech, 12926-1-AP, SKAP2 Polyclonal antibody

CATALOG NUMBER: 12926-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SKAP2 (12926-1-AP) by Proteintech is a Polyclonal antibody targeting SKAP2 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 12926-1-AP targets SKAP2 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, NIH/3T3 cells Positive IP detected in: mouse liver tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SKAP2 (src kinase associated phosphoprotein 2), also named PRAP, contains PH domain and SH3 domain. It is localized in cytoplasm and was expressed in ubiquitously in various tissues including lung, skeletal muscle, and spleen, but not detectable in thymus and T cell lymphoma cells. SKAP2 may negatively regulate alpha-synuclein phosphorylation following cell stress. SKAP2 may be involved in B-cell and macrophage adhesion processes by coupling the B-cell receptor (BCR) to integrin activation. Observed MW of SKAP2 is 55 kDa(PMID: 23161539). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3615 Product name: Recombinant human SKAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-359 aa of BC036044 Sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI Predict reactive species Full Name: src kinase associated phosphoprotein 2 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC036044 Gene Symbol: SKAP2 Gene ID (NCBI): 8935 RRID: AB_2189317 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75563 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924